Recombinant Human NOCT Protein, GST-Tagged

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector. [provided by RefSeq, Jul 2008]
Molecular Mass :	35.53 kDa
AA Sequence :	VCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQWNILA
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	NOCT nocturnin [ Homo sapiens (human) ]
Official Symbol	NOCT
Synonyms	NOCT; nocturnin; CCRN4L; CCR4 carbon catabolite repression 4-like (S. cerevisiae); CCR4 like (carbon catabolite repression 4, S.cerevisiae); nocturnin; CCR4; CCR4L; CCR4 protein homolog; CCR4-like (carbon catabolite repression 4, S.cerevisiae); NOC; MGC78549; MGC142054; MGC142060; MGC4120817;
Gene ID	25819
mRNA Refseq	NM_012118
Protein Refseq	NP_036250
MIM	608468
UniProt ID	Q9UK39