Recombinant Human NOCT Protein, GST-Tagged

• Cat.No.: NOCT-0706H
• Product Overview: Human CCRN4L partial ORF (NP_036250, 64 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is highly similar to Nocturnin, a gene identified as a circadian clock regulated gene in Xenopus laevis. This protein and Nocturnin protein share similarity with the C-terminal domain of a yeast transcription factor, carbon catabolite repression 4 (CCR4). The mRNA abundance of a similar gene in mouse has been shown to exhibit circadian rhythmicity, which suggests a role for this protein in clock function or as a circadian clock effector. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.53 kDa
• AA Sequence: VCSMGTGTSRLYSALAKTLNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVDLRTDCPSTHPPIRVMQWNILA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NOCT nocturnin [ Homo sapiens (human) ]
• Official Symbol: NOCT
• Synonyms: NOCT; nocturnin; CCRN4L; CCR4 carbon catabolite repression 4-like (S. cerevisiae); CCR4 like (carbon catabolite repression 4, S.cerevisiae); nocturnin; CCR4; CCR4L; CCR4 protein homolog; CCR4-like (carbon catabolite repression 4, S.cerevisiae); NOC; MGC78549; MGC142054; MGC142060; MGC4120817
• Gene ID: 25819
• mRNA Refseq: NM_012118
• Protein Refseq: NP_036250
• MIM: 608468
• UniProt ID: Q9UK39