Recombinant Human NODAL
Cat.No. : | NODAL-30448TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 275-346 of Human Nodal, with an N-terminal proprietary tag, predicted MWt 33.55kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 72 amino acids |
Description : | The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development. |
Molecular Weight : | 33.550kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC |
Sequence Similarities : | Belongs to the TGF-beta family. |
Gene Name | NODAL nodal homolog (mouse) [ Homo sapiens ] |
Official Symbol | NODAL |
Synonyms | NODAL; nodal homolog (mouse); nodal, mouse, homolog; nodal homolog; |
Gene ID | 4838 |
mRNA Refseq | NM_018055 |
Protein Refseq | NP_060525 |
MIM | 601265 |
Uniprot ID | Q96S42 |
Chromosome Location | 10q22.1 |
Pathway | Developmental Biology, organism-specific biosystem; Regulation of Signaling by NODAL, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | cytokine activity; growth factor activity; |
◆ Recombinant Proteins | ||
NODAL-0528H | Recombinant Human NODAL protein, GST-tagged | +Inquiry |
NODAL-5964H | Recombinant Human NODAL Protein, GST-tagged | +Inquiry |
NODAL-235H | Active Recombinant Human NODAL Protein (His238-Leu347), C-His tagged, Animal-free, Carrier-free | +Inquiry |
NODAL-3648H | Recombinant Human NODAL Protein, His (Fc)-Avi-tagged | +Inquiry |
NODAL-28M | Recombinant Mouse Nodal | +Inquiry |
◆ Cell & Tissue Lysates | ||
NODAL-3771HCL | Recombinant Human NODAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NODAL Products
Required fields are marked with *
My Review for All NODAL Products
Required fields are marked with *
0
Inquiry Basket