Recombinant Human NOX4 Protein, GST-tagged
Cat.No. : | NOX4-6008H |
Product Overview : | Human NOX4 partial ORF ( NP_058627.1, 479 a.a. - 578 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NOX4 NADPH oxidase 4 [ Homo sapiens ] |
Official Symbol | NOX4 |
Synonyms | NOX4; NADPH oxidase 4; KOX; KOX 1; kidney oxidase-1; renal NAD(P)H-oxidase; kidney superoxide-producing NADPH oxidase; KOX-1; RENOX; |
Gene ID | 50507 |
mRNA Refseq | NM_001143836 |
Protein Refseq | NP_001137308 |
MIM | 605261 |
UniProt ID | Q9NPH5 |
◆ Recombinant Proteins | ||
NOX4-2948H | Recombinant Human NOX4 Transmembrane protein, His-tagged | +Inquiry |
NOX4-29711TH | Recombinant Human NOX4 | +Inquiry |
NOX4-2200R | Recombinant Rat NOX4 Protein (210-424 aa), His-B2M-tagged | +Inquiry |
NOX4-1539HF | Recombinant Full Length Human NOX4 Protein | +Inquiry |
NOX4-298H | Recombinant Human NOX4 protein, His-tagged(VLPs) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *
0
Inquiry Basket