Recombinant Human NOX4 protein, His-tagged
| Cat.No. : | NOX4-3282H |
| Product Overview : | Recombinant Human NOX4 protein(Q9NPH5)(210-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 210-424aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.8 kDa |
| AA Sequence : | GGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYE |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | NOX4 NADPH oxidase 4 [ Homo sapiens ] |
| Official Symbol | NOX4 |
| Synonyms | NOX4; NADPH oxidase 4; KOX; KOX 1; kidney oxidase-1; renal NAD(P)H-oxidase; kidney superoxide-producing NADPH oxidase; KOX-1; RENOX; |
| Gene ID | 50507 |
| mRNA Refseq | NM_001143836 |
| Protein Refseq | NP_001137308 |
| MIM | 605261 |
| UniProt ID | Q9NPH5 |
| ◆ Recombinant Proteins | ||
| NOX4-4032R | Recombinant Rat NOX4 Protein | +Inquiry |
| NOX4-1977H | Recombinant Human NOX4 protein, His-tagged | +Inquiry |
| NOX4-1539HF | Recombinant Full Length Human NOX4 Protein | +Inquiry |
| NOX4-2783H | Recombinant Human NOX4 Protein (Gly210-Glu424), His tagged | +Inquiry |
| Nox4-1840M | Recombinant Mouse Nox4 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NOX4 Products
Required fields are marked with *
My Review for All NOX4 Products
Required fields are marked with *



