Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Join NIH Research Festival Biotech Vendor Exhibits 2024 | Sep. 25th, 2024

Recombinant Human NPM1

Cat.No. : NPM1-27765TH
Product Overview : Recombinant full length Human Nucleophosmin with N terminal proprietary tag, 58.45kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a phosphoprotein which moves between the nucleus and the cytoplasm. The gene product is thought to be involved in several processes including regulation of the ARF/p53 pathway. A number of genes are fusion partners have been characterized, in particular the anaplastic lymphoma kinase gene on chromosome 2. Mutations in this gene are associated with acute myeloid leukemia. More than a dozen pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.
Protein length : 295 amino acids
Molecular Weight : 58.450kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEH QLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLK MSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE EDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAA DEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTP AKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKG PSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD QEAIQDLWQWRKSL
Sequence Similarities : Belongs to the nucleoplasmin family.
Tag : Non
Gene Name : NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
Official Symbol : NPM1
Synonyms : NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin;
Gene ID : 4869
mRNA Refseq : NM_001037738
Protein Refseq : NP_001032827
MIM : 164040
Uniprot ID : P06748
Chromosome Location : 5q35.1
Pathway : Aurora B signaling, organism-specific biosystem; BARD1 signaling events, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Deposition of New CENPA-containing Nucleosomes at the Centromere, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem;
Function : NF-kappaB binding; NF-kappaB binding; RNA binding; Tat protein binding; histone binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All NPM1 Products

Required fields are marked with *

My Review for All NPM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends