Recombinant Human NRCAM
Cat.No. : | NRCAM-30412TH |
Product Overview : | Recombinant fragment of Human NrCAM with a proprietary tag; predicted MWt 37.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Detected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVL |
Sequence Similarities : | Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.Contains 5 fibronectin type-III domains.Contains 6 Ig-like C2-type (immunoglobulin-like) domains. |
Gene Name | NRCAM neuronal cell adhesion molecule [ Homo sapiens ] |
Official Symbol | NRCAM |
Synonyms | NRCAM; neuronal cell adhesion molecule; Bravo; KIAA0343; NgCAM related cell adhesion molecule; |
Gene ID | 4897 |
mRNA Refseq | NM_001037132 |
Protein Refseq | NP_001032209 |
MIM | 601581 |
Uniprot ID | Q92823 |
Chromosome Location | 7q31 |
Pathway | Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; |
Function | ankyrin binding; |
◆ Recombinant Proteins | ||
NRCAM-30412TH | Recombinant Human NRCAM | +Inquiry |
NRCAM-6113H | Recombinant Human NRCAM Protein, GST-tagged | +Inquiry |
NRCAM-1665H | Recombinant Human NRCAM protein, His & GST-tagged | +Inquiry |
NRCAM-6818C | Recombinant Chicken NRCAM | +Inquiry |
NRCAM-8675H | Recombinant Human NRCAM protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NRCAM-1220HCL | Recombinant Human NRCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRCAM Products
Required fields are marked with *
My Review for All NRCAM Products
Required fields are marked with *
0
Inquiry Basket