Recombinant Human NRCAM

Cat.No. : NRCAM-30412TH
Product Overview : Recombinant fragment of Human NrCAM with a proprietary tag; predicted MWt 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Detected in all the examined tissues. In the brain it was detected in the amygdala, caudate nucleus, corpus callosum, hippocampus, hypothalamus, substantia nigra, subthalamic nucleus and thalamus.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : YIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVL
Sequence Similarities : Belongs to the immunoglobulin superfamily. L1/neurofascin/NgCAM family.Contains 5 fibronectin type-III domains.Contains 6 Ig-like C2-type (immunoglobulin-like) domains.
Gene Name NRCAM neuronal cell adhesion molecule [ Homo sapiens ]
Official Symbol NRCAM
Synonyms NRCAM; neuronal cell adhesion molecule; Bravo; KIAA0343; NgCAM related cell adhesion molecule;
Gene ID 4897
mRNA Refseq NM_001037132
Protein Refseq NP_001032209
MIM 601581
Uniprot ID Q92823
Chromosome Location 7q31
Pathway Axon guidance, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem;
Function ankyrin binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRCAM Products

Required fields are marked with *

My Review for All NRCAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon