Recombinant Human NRCAM Protein, GST-tagged
| Cat.No. : | NRCAM-6113H |
| Product Overview : | Human NRCAM partial ORF ( NP_005001, 50 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | YIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | NRCAM neuronal cell adhesion molecule [ Homo sapiens ] |
| Official Symbol | NRCAM |
| Synonyms | NRCAM; neuronal cell adhesion molecule; Bravo; KIAA0343; NgCAM related cell adhesion molecule; neuronal surface protein Bravo; NgCAM-related cell adhesion molecule; MGC138845; MGC138846; |
| Gene ID | 4897 |
| mRNA Refseq | NM_001037132 |
| Protein Refseq | NP_001032209 |
| MIM | 601581 |
| UniProt ID | Q92823 |
| ◆ Recombinant Proteins | ||
| NRCAM-6818C | Recombinant Chicken NRCAM | +Inquiry |
| NRCAM-6113H | Recombinant Human NRCAM Protein, GST-tagged | +Inquiry |
| NRCAM-4737H | Recombinant Human NRCAM Protein (Gln25-Asn600), C-Fc tagged | +Inquiry |
| NRCAM-1665H | Recombinant Human NRCAM protein, His & GST-tagged | +Inquiry |
| NRCAM-544H | Recombinant Human NRCAM | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NRCAM-1220HCL | Recombinant Human NRCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NRCAM Products
Required fields are marked with *
My Review for All NRCAM Products
Required fields are marked with *
