Recombinant Human NRCAM Protein, GST-tagged

Cat.No. : NRCAM-6113H
Product Overview : Human NRCAM partial ORF ( NP_005001, 50 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. This gene encodes a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. This gene is also expressed in non-neural tissues and may play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of this gene have been associated with autism and addiction vulnerability. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : YIIDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDPLVTMKPGTGTLIINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSRSPLWTKEKLEPITLQSGQSLVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name NRCAM neuronal cell adhesion molecule [ Homo sapiens ]
Official Symbol NRCAM
Synonyms NRCAM; neuronal cell adhesion molecule; Bravo; KIAA0343; NgCAM related cell adhesion molecule; neuronal surface protein Bravo; NgCAM-related cell adhesion molecule; MGC138845; MGC138846;
Gene ID 4897
mRNA Refseq NM_001037132
Protein Refseq NP_001032209
MIM 601581
UniProt ID Q92823

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRCAM Products

Required fields are marked with *

My Review for All NRCAM Products

Required fields are marked with *

0
cart-icon
0
compare icon