Recombinant Human NTF4 Protein

Cat.No. : NTF4-219H
Product Overview : Recombinant Human NTF4 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Neurotrophin-4 (NT-4) is an important member of the nerve growth factor (NGF) family of proteins. Neurotrophins undergo paracrine and autocrine signaling to control neuronal survival, neuronal differentiation, and dendrite outgrowth. NT-4 is expressed ubiquitously and signals through the TrkB receptor tryrosine kinase.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : noncovalent homodimer, 14.1/28.1 kDa (131/262 aa)
AA Sequence : MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name NTF4 neurotrophin 4 [ Homo sapiens (human) ]
Official Symbol NTF4
Synonyms NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5;
Gene ID 4909
mRNA Refseq NM_006179
Protein Refseq NP_006170
MIM 162662
UniProt ID P34130

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NTF4 Products

Required fields are marked with *

My Review for All NTF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon