Recombinant Human NTF4 protein, His-tagged
| Cat.No. : | NTF4-3294H |
| Product Overview : | Recombinant Human NTF4 protein(P34130)(82-210aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 82-210aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.9 kDa |
| AA Sequence : | VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | NTF4 neurotrophin 4 [ Homo sapiens ] |
| Official Symbol | NTF4 |
| Synonyms | NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5; |
| Gene ID | 4909 |
| mRNA Refseq | NM_006179 |
| Protein Refseq | NP_006170 |
| MIM | 162662 |
| UniProt ID | P34130 |
| ◆ Recombinant Proteins | ||
| NTF4-3114R | Recombinant Rhesus monkey NTF4 Protein, His-tagged | +Inquiry |
| NTF4-1385H | Recombinant Human NTF4, GST-tagged | +Inquiry |
| NTF4-089H | Active Recombinant Human NTF4 Protein | +Inquiry |
| NTF4-2933R | Recombinant Rhesus Macaque NTF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| NTF4-013H | Active Recombinant Human NTF4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NTF4-3669HCL | Recombinant Human NTF4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NTF4 Products
Required fields are marked with *
My Review for All NTF4 Products
Required fields are marked with *



