Recombinant Human NTF4 protein, His-tagged

Cat.No. : NTF4-3294H
Product Overview : Recombinant Human NTF4 protein(P34130)(82-210aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 82-210aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.9 kDa
AA Sequence : VSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name NTF4 neurotrophin 4 [ Homo sapiens ]
Official Symbol NTF4
Synonyms NTF4; neurotrophin 4; neurotrophin 5 (neurotrophin 4/5) , NTF5; neurotrophin-4; GLC1O; neurotrophic factor 4; NT 4/5; neurotrophin-5; neutrophic factor 4; neurotrophic factor 5; neurotrophin 5 (neurotrophin 4/5); NT4; NT5; NT-4; NT-5; NTF5; GLC10; NT-4/5;
Gene ID 4909
mRNA Refseq NM_006179
Protein Refseq NP_006170
MIM 162662
UniProt ID P34130

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NTF4 Products

Required fields are marked with *

My Review for All NTF4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon