Recombinant Human P2RX7 Protein, GST-tagged

Cat.No. : P2RX7-390H
Product Overview : Human P2RX7 full-length ORF ( AAH11913.1, 1 a.a. - 595 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-595
Description : The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression. Multiple alternatively spliced variants have been identified, most of which fit nonsense-mediated decay (NMD) criteria.
Molecular Mass : 94.9 kDa
AA Sequence : MPACCSCSDVFQYETNKVTRIQSMNYGTIKWFFHVIIFSYVCFALVSDKLYQRKEPVISSVHTKVKGIAEVKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCPEYPTRRTLCSSDRGCKKGWMDPQSKGIQTGRCVVHEGNQKTCEVSAWCPIEAVEEAPRPALLNSAENFTVLIKNNIDFPGHNYTTRNILPGLNITCTFHKTQNPQCPIFRLGDIFRETGDNFSDVAIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Gene Name P2RX7 purinergic receptor P2X 7 [ Homo sapiens (human) ]
Official Symbol P2RX7
Synonyms P2RX7; purinergic receptor P2X 7; P2X7; P2X purinoceptor 7; ATP receptor; P2X7 receptor; P2Z receptor; purinergic receptor P2X, ligand gated ion channel, 7; purinergic receptor P2X7 variant A; purnergic receptor P2X 7
Gene ID 5027
mRNA Refseq NM_002562
Protein Refseq NP_002553
MIM 602566
UniProt ID Q99572

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All P2RX7 Products

Required fields are marked with *

My Review for All P2RX7 Products

Required fields are marked with *

0
cart-icon