Recombinant Human PLA2G12A protein, His&Myc-tagged

Cat.No. : PLA2G12A-2337H
Product Overview : Recombinant Human PLA2G12A protein(Q9BZM1)(23-189aa) was fused to N-terminal His tag and C-terminal Myc tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : His&Myc
Protein Length : 23-189aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 22.6 kDa
AA Sequence : QEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDL
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name PLA2G12A phospholipase A2, group XIIA [ Homo sapiens ]
Official Symbol PLA2G12A
Synonyms PLA2G12A; phospholipase A2, group XIIA; phospholipase A2, group XII , PLA2G12; group XIIA secretory phospholipase A2; sPLA2-XII; GXII sPLA2; group XII secreted phospholipase A2; group XIIA secreted phospholipase A2; phosphatidylcholine 2-acylhydrolase 12A; GXII; ROSSY; PLA2G12;
Gene ID 81579
mRNA Refseq NM_030821
Protein Refseq NP_110448
MIM 611652
UniProt ID Q9BZM1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G12A Products

Required fields are marked with *

My Review for All PLA2G12A Products

Required fields are marked with *

0
cart-icon