Recombinant Full Length Human PLA2G12A Protein, C-Flag-tagged
| Cat.No. : | PLA2G12A-207HFL |
| Product Overview : | Recombinant Full Length Human PLA2G12A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Secreted phospholipase A2 (sPLA2) enzymes liberate arachidonic acid from phospholipids for production of eicosanoids and exert a variety of physiologic and pathologic effects. Group XII sPLA2s, such as PLA2G12A, have relatively low specific activity and are structurally and functionally distinct from other sPLA2s. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 20.9 kDa |
| AA Sequence : | MALLSRPALTLLLLLMAAVVRCQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLLGGEDGLCQYKCSDG SKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQ KTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHYEEKTDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Secreted Protein |
| Protein Pathways : | alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway |
| Full Length : | Full L. |
| Gene Name | PLA2G12A phospholipase A2 group XIIA [ Homo sapiens (human) ] |
| Official Symbol | PLA2G12A |
| Synonyms | GXII; ROSSY; PLA2G12 |
| Gene ID | 81579 |
| mRNA Refseq | NM_030821.5 |
| Protein Refseq | NP_110448.2 |
| MIM | 611652 |
| UniProt ID | Q9BZM1 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G12A Products
Required fields are marked with *
My Review for All PLA2G12A Products
Required fields are marked with *
Recently Viewed
