Recombinant Human PLEC Protein, GST-tagged

Cat.No. : PLEC1-32H
Product Overview : Human PLEC1 partial ORF ( NP_000436, 4384 a.a. - 4493 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PLEC plectin [ Homo sapiens (human) ]
Official Symbol PLEC
Synonyms HD1; PCN; EBS1; EBSO; PLEC1b; PLTN; Hemidesmosomal protein 1; Intermediate Filament Binding Protein 500kDa; Epidermolysis Bullosa Simplex 1(Ogna)
Gene ID 5339
mRNA Refseq NM_000445.4
Protein Refseq NP_000436.2
MIM 601282
UniProt ID Q15149

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLEC Products

Required fields are marked with *

My Review for All PLEC Products

Required fields are marked with *

0
cart-icon