Recombinant Human PLEC Protein, GST-tagged
Cat.No. : | PLEC1-32H |
Product Overview : | Human PLEC1 partial ORF ( NP_000436, 4384 a.a. - 4493 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | PLEC plectin [ Homo sapiens (human) ] |
Official Symbol | PLEC |
Synonyms | HD1; PCN; EBS1; EBSO; PLEC1b; PLTN; Hemidesmosomal protein 1; Intermediate Filament Binding Protein 500kDa; Epidermolysis Bullosa Simplex 1(Ogna) |
Gene ID | 5339 |
mRNA Refseq | NM_000445.4 |
Protein Refseq | NP_000436.2 |
MIM | 601282 |
UniProt ID | Q15149 |
◆ Recombinant Proteins | ||
PLEC-30873TH | Recombinant Human PLEC, His-tagged | +Inquiry |
PLEC-1877H | Recombinant Human PLEC protein, His-tagged | +Inquiry |
PLEC1-32H | Recombinant Human PLEC Protein, GST-tagged | +Inquiry |
PLEC-1357H | Recombinant Human PLEC Protein, His-tagged | +Inquiry |
PLEC-32H | Recombinant Human PLEC Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PLEC Products
Required fields are marked with *
My Review for All PLEC Products
Required fields are marked with *
0
Inquiry Basket