Recombinant Human PLEC Protein, GST-tagged

• Cat.No.: PLEC-32H
• Product Overview: Recombinant Human PLEC(4384 a.a. - 4493 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 4384 a.a. - 4493 a.a.
• Description: Plectin is a prominent member of an important family of structurally and in part functionally related proteins, termed plakins or cytolinkers, that are capable of interlinking different elements of the cytoskeleton.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.84 kDa
• AA Sequence: CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: PLEC plectin [ Homo sapiens ]
• Official Symbol: PLEC
• Synonyms: PLEC; plectin; EBS1, epidermolysis bullosa simplex 1 (Ogna) , PLEC1, plectin 1, intermediate filament binding protein 500kDa , plectin 1, intermediate filament binding protein, 500kD; PCN; PLTN; plectin-1; hemidesmosomal protein 1; plectin 1, intermediate filament binding protein 500kDa; HD1; EBS1; EBSO; PLEC1; LGMD2Q; PLEC1b
• Gene ID: 5339
• mRNA Refseq: NM_000445
• Protein Refseq: NP_000436
• MIM: 601282
• UniProt ID: Q15149