Recombinant Human PLEC Protein, GST-tagged
| Cat.No. : | PLEC-32H |
| Product Overview : | Recombinant Human PLEC(4384 a.a. - 4493 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 4384 a.a. - 4493 a.a. |
| Description : | Plectin is a prominent member of an important family of structurally and in part functionally related proteins, termed plakins or cytolinkers, that are capable of interlinking different elements of the cytoskeleton. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PLEC plectin [ Homo sapiens ] |
| Official Symbol | PLEC |
| Synonyms | PLEC; plectin; EBS1, epidermolysis bullosa simplex 1 (Ogna) , PLEC1, plectin 1, intermediate filament binding protein 500kDa , plectin 1, intermediate filament binding protein, 500kD; PCN; PLTN; plectin-1; hemidesmosomal protein 1; plectin 1, intermediate filament binding protein 500kDa; HD1; EBS1; EBSO; PLEC1; LGMD2Q; PLEC1b; |
| Gene ID | 5339 |
| mRNA Refseq | NM_000445 |
| Protein Refseq | NP_000436 |
| MIM | 601282 |
| UniProt ID | Q15149 |
| ◆ Recombinant Proteins | ||
| PLEC-1877H | Recombinant Human PLEC protein, His-tagged | +Inquiry |
| PLEC-30873TH | Recombinant Human PLEC, His-tagged | +Inquiry |
| PLEC-1837H | Recombinant Human PLEC protein, GST-tagged | +Inquiry |
| PLEC-1357H | Recombinant Human PLEC Protein, His-tagged | +Inquiry |
| PLEC1-32H | Recombinant Human PLEC Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLEC Products
Required fields are marked with *
My Review for All PLEC Products
Required fields are marked with *
