Recombinant Human PLEC Protein, GST-tagged

Cat.No. : PLEC-32H
Product Overview : Recombinant Human PLEC(4384 a.a. - 4493 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 4384 a.a. - 4493 a.a.
Description : Plectin is a prominent member of an important family of structurally and in part functionally related proteins, termed plakins or cytolinkers, that are capable of interlinking different elements of the cytoskeleton.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name PLEC plectin [ Homo sapiens ]
Official Symbol PLEC
Synonyms PLEC; plectin; EBS1, epidermolysis bullosa simplex 1 (Ogna) , PLEC1, plectin 1, intermediate filament binding protein 500kDa , plectin 1, intermediate filament binding protein, 500kD; PCN; PLTN; plectin-1; hemidesmosomal protein 1; plectin 1, intermediate filament binding protein 500kDa; HD1; EBS1; EBSO; PLEC1; LGMD2Q; PLEC1b;
Gene ID 5339
mRNA Refseq NM_000445
Protein Refseq NP_000436
MIM 601282
UniProt ID Q15149

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLEC Products

Required fields are marked with *

My Review for All PLEC Products

Required fields are marked with *

0
cart-icon
0
compare icon