Recombinant Human PlGF-3 Protein

Cat.No. : PGF-226H
Product Overview : Recombinant Human PlGF-3 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family and promotes endothelial cell growth and angiogenesis. PlGF is secreted as a homodimer and may also form a heterodimer with VEGF. PlGF is detected in the placenta, heart, lungs, thyroid, and adipose tissues. Circulating PlGF levels are correlated with colorectal and renal cancers, as well as atherosclerosis and ischemic heart disease. There are four alternatively spliced PlGF isoforms (PlGF-1, PlGF-2, PlGF-3, and PlGF-4), each with unique secretion patterns and heparin-binding affinities. PlGF-3 lacks a heparin-binding domain and signals through the VEGFR-1 receptor.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Dimer, 22.9/45.8 kDa (with 204/408 amino acids)
AA Sequence : MLPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR
Endotoxin : ≤1 EUs/μg, Kinetic LAL (50% confidence)
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name PGF placental growth factor [ Homo sapiens (human) ]
Official Symbol PGF
Synonyms PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760;
Gene ID 5228
mRNA Refseq NM_001207012
Protein Refseq NP_001193941
MIM 601121
UniProt ID P49763

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PGF Products

Required fields are marked with *

My Review for All PGF Products

Required fields are marked with *

0
cart-icon