Recombinant Human PGF protein, His-SUMO-tagged
Cat.No. : | PGF-3333H |
Product Overview : | Recombinant Human PGF protein(P49763)(19-170aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-170aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.3 kDa |
AA Sequence : | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | PGF placental growth factor [ Homo sapiens ] |
Official Symbol | PGF |
Synonyms | PGF; placental growth factor; PGFL, placental growth factor, vascular endothelial growth factor related protein , placental growth factor like; placenta growth factor; D12S1900; PlGF; PLGF; PlGF 2; SHGC 10760; placental growth factor-like; placental growth factor, vascular endothelial growth factor-related protein; PGFL; PlGF-2; SHGC-10760; |
Gene ID | 5228 |
mRNA Refseq | NM_001207012 |
Protein Refseq | NP_001193941 |
MIM | 601121 |
UniProt ID | P49763 |
◆ Recombinant Proteins | ||
PGF-100H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-0042H | Recombinant Human PGF Protein | +Inquiry |
PGF-102H | Active Recombinant Human PGF Protein | +Inquiry |
PGF-3333H | Recombinant Human PGF protein, His-SUMO-tagged | +Inquiry |
Pgf-6053MFL | Recombinant Full Length Mouse Pgf, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PGF-1118MCL | Recombinant Mouse PGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PGF Products
Required fields are marked with *
My Review for All PGF Products
Required fields are marked with *
0
Inquiry Basket