Recombinant Human Prostaglandin D2 Synthase 21kDa (Brain), His-tagged

Cat.No. : PTGDS-101H
Product Overview : Recombinant Human PTGDS His-Tagged Protein, produced inE. coli, is 20.3 kDa protein containing 168 amino acid residues of the human BTP and 14 additional amino acid residues - His-Tagged.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Beta-Trace catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system. It has been proposed that the urinary and serum levels may provide a sensitive indicator of renal damage in diabetes mellitus and hypertension. Elevated levels in the coronary circulation may also be associated with angina. Changes in charge and molecular weight microheterogeneity, due to modification of the N-linked oligosaccharides, may be associated with neurodegenerative disease and multiple sclerosis. Detected in meningioma but not in other brain tumors and may be considered a specific cell marker for meningioma.
Amino Acid Sequence : MRGSHHHHHHGMASAPEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKNQCETRTMLLQP AGSLGSYSYR SPHWGSTYSV SVVETDYDQY ALLYSQGSKG PGEDFRMATL YSRTQTPRAE LKEKFTAFCK AQGFTEDTIV FLPQTDKCMT EQ
Physical Appearance : Sterile Filtered White lyophilized (freeze-dried) powder.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : Filtered (0.4 micron) and lyophilized from 0.5 mg/ml in 20mM Tris buffer, 20mM NaCl, pH 7.5.
Solubility : It is recommended to reconstitute the lyophilized Beta-Trace in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Storage : Lyophilized PGDS2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution PDS should be stored at 4°Cbetween 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name PTGDS prostaglandin D2 synthase 21kDa (brain) [ Homo sapiens ]
Synonyms PTGDS; prostaglandin D2 synthase 21kDa (brain); PDS; PGD2; PGDS; LPGDS; PGDS2; L-PGDS; PGD2 synthase; beta-trace protein; prostaglandin D synthase; prostaglandin-H2 D-isomerase; glutathione-independent PGD synthase; lipocalin-type prostaglandin D synthase; EC 5.3.99.2; prostaglandin D2 synthase (21kD, brain); Prostaglandin-D2 synthase; Beta-trace protein; Cerebrin-28; OTTHUMP00000022638; prostaglandin D2 synthase 21kDa (brain); prostaglandin H2 D-isomerase
Gene ID 5730
mRNA Refseq NM_000954
Protein Refseq NP_000945
MIM 176803
UniProt ID P41222
Chromosome Location 9q34.2-q34.3
Pathway Arachidonic acid metabolism; Metabolic pathways
Function fatty acid biosynthetic process; prostaglandin biosynthetic process; regulation of circadian sleep/wake cycle, sleep; transport

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGDS Products

Required fields are marked with *

My Review for All PTGDS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon