Recombinant Human RHOB, His-tagged
Cat.No. : | RHOB-27380TH |
Product Overview : | Recombinant full length Human mature RHOB with an N terminal His tag; 213 amino acids, predicted MWt 23.9kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 193 amino acids |
Description : | Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. |
Conjugation : | HIS |
Molecular Weight : | 23.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC |
Sequence Similarities : | Belongs to the small GTPase superfamily. Rho family. |
Gene Name | RHOB ras homolog gene family, member B [ Homo sapiens ] |
Official Symbol | RHOB |
Synonyms | RHOB; ras homolog gene family, member B; ARH6, ARHB; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; |
Gene ID | 388 |
mRNA Refseq | NM_004040 |
Protein Refseq | NP_004031 |
MIM | 165370 |
Uniprot ID | P62745 |
Chromosome Location | 2p24 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; |
Function | GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
RHOB-5036R | Recombinant Rat RHOB Protein | +Inquiry |
RHOB-14168M | Recombinant Mouse RHOB Protein | +Inquiry |
RHOB-3702R | Recombinant Rhesus Macaque RHOB Protein, His (Fc)-Avi-tagged | +Inquiry |
RHOB-2291H | Recombinant Human RHOB protein, GST-tagged | +Inquiry |
RHOB-27380TH | Recombinant Human RHOB, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RHOB-2356HCL | Recombinant Human RHOB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RHOB Products
Required fields are marked with *
My Review for All RHOB Products
Required fields are marked with *