Recombinant Human RHOB, His-tagged

Cat.No. : RHOB-27380TH
Product Overview : Recombinant full length Human mature RHOB with an N terminal His tag; 213 amino acids, predicted MWt 23.9kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 193 amino acids
Description : Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation.
Conjugation : HIS
Molecular Weight : 23.900kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCC
Sequence Similarities : Belongs to the small GTPase superfamily. Rho family.
Gene Name RHOB ras homolog gene family, member B [ Homo sapiens ]
Official Symbol RHOB
Synonyms RHOB; ras homolog gene family, member B; ARH6, ARHB; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6;
Gene ID 388
mRNA Refseq NM_004040
Protein Refseq NP_004031
MIM 165370
Uniprot ID P62745
Chromosome Location 2p24
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; G alpha (12/13) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem;
Function GDP binding; GTP binding; GTPase activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOB Products

Required fields are marked with *

My Review for All RHOB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon