Recombinant Human RHOB protein, GST-tagged

Cat.No. : RHOB-2291H
Product Overview : Recombinant Human RHOB protein(1-196 aa), fused with N-terminal GST tag, was expressed in E. coli.
Availability August 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E. coli
Tag : GST
Protein Length : 1-196 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Purity : 90%, by SDS-PAGE.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name RHOB ras homolog family member B [ Homo sapiens ]
Official Symbol RHOB
Synonyms RHOB; ras homolog family member B; ARH6, ARHB, ras homolog gene family, member B; rho-related GTP-binding protein RhoB; MST081; oncogene RHO H6; RhoB; RHOH6; h6; rho cDNA clone 6; Aplysia RAS-related homolog 6; ras homolog gene family, member B; ARH6; ARHB; MSTP081;
mRNA Refseq NM_004040
Protein Refseq NP_004031
MIM 165370
UniProt ID P62745
Gene ID 388

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RHOB Products

Required fields are marked with *

My Review for All RHOB Products

Required fields are marked with *

0
cart-icon