Recombinant Human SART3 Protein (600-900 aa), His-tagged
Cat.No. : | SART3-1664H |
Product Overview : | Recombinant Human SART3 Protein (600-900 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 600-900 aa |
Description : | U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085). Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assembly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites (PubMed:14749385). May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassembly (PubMed:20595234). May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair (PubMed:24526689). May play a role in hematopoiesis probably through transcription regulation of specific genes including MYC (By similarity).By similarity4 Publications Regulates Tat transactivation activity through direct interaction. May be a cellular factor for HIV-1 gene expression and viral replication. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 35.8 kDa |
AA Sequence : | QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | SART3 squamous cell carcinoma antigen recognized by T cells 3 [ Homo sapiens ] |
Official Symbol | SART3 |
Synonyms | SART3; KIAA0156; RP11 13G14; SART-3; hSART-3; P100; p110; DSAP1; TIP110; p110(nrb); RP11-13G14; MGC138188; |
Gene ID | 9733 |
mRNA Refseq | NM_014706 |
Protein Refseq | NP_055521 |
MIM | 611684 |
UniProt ID | Q15020 |
◆ Recombinant Proteins | ||
SART3-1664H | Recombinant Human SART3 Protein (600-900 aa), His-tagged | +Inquiry |
SART3-1955H | Recombinant Human SART3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SART3-3244Z | Recombinant Zebrafish SART3 | +Inquiry |
SART3-7906M | Recombinant Mouse SART3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SART3-3894R | Recombinant Rhesus Macaque SART3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SART3-2058HCL | Recombinant Human SART3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SART3 Products
Required fields are marked with *
My Review for All SART3 Products
Required fields are marked with *
0
Inquiry Basket