Recombinant Human SIRT3, His-tagged

Cat.No. : SIRT3-30594TH
Product Overview : Recombinant fragment of Human SIRT3 with N terminal His tag; 303aa, 33.5kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 282 amino acids
Description : This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene.
Conjugation : HIS
Molecular Weight : 33.500kDa inclusive of tags
Tissue specificity : Widely expressed.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Sequence Similarities : Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain.
Gene Name SIRT3 sirtuin 3 [ Homo sapiens ]
Official Symbol SIRT3
Synonyms SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3;
Gene ID 23410
mRNA Refseq NM_001017524
Protein Refseq NP_001017524
MIM 604481
Uniprot ID Q9NTG7
Chromosome Location 11p15.5
Pathway Energy Metabolism, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class III, organism-specific biosystem;
Function NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; hydrolase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIRT3 Products

Required fields are marked with *

My Review for All SIRT3 Products

Required fields are marked with *

0
cart-icon