Recombinant Human SIRT3, His-tagged
Cat.No. : | SIRT3-30594TH |
Product Overview : | Recombinant fragment of Human SIRT3 with N terminal His tag; 303aa, 33.5kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 282 amino acids |
Description : | This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. |
Conjugation : | HIS |
Molecular Weight : | 33.500kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFF HNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK |
Sequence Similarities : | Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain. |
Gene Name | SIRT3 sirtuin 3 [ Homo sapiens ] |
Official Symbol | SIRT3 |
Synonyms | SIRT3; sirtuin 3; sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S.cerevisiae, homolog) 3; NAD-dependent deacetylase sirtuin-3, mitochondrial; SIR2L3; |
Gene ID | 23410 |
mRNA Refseq | NM_001017524 |
Protein Refseq | NP_001017524 |
MIM | 604481 |
Uniprot ID | Q9NTG7 |
Chromosome Location | 11p15.5 |
Pathway | Energy Metabolism, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem; Signaling events mediated by HDAC Class III, organism-specific biosystem; |
Function | NOT NAD+ ADP-ribosyltransferase activity; NAD+ binding; hydrolase activity; hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides; metal ion binding; |
◆ Recombinant Proteins | ||
Sirt3-1375M | Recombinant Mouse Sirt3 protein, His-tagged | +Inquiry |
SIRT3-7843H | Recombinant Human SIRT3 protein, His-tagged | +Inquiry |
SIRT3-7845H | Recombinant Human SIRT3 protein, His-tagged | +Inquiry |
SIRT3-28H | Recombinant Human SIRT3 Protein, His-tagged | +Inquiry |
SIRT3-346H | Active Recombinant Human SIRT3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIRT3-1832HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
SIRT3-1833HCL | Recombinant Human SIRT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SIRT3 Products
Required fields are marked with *
My Review for All SIRT3 Products
Required fields are marked with *
0
Inquiry Basket