Recombinant Human SLPI, His-tagged

Cat.No. : SLPI-30969TH
Product Overview : Recombinant full length Human SLPI with an N terminal His tag; 128 amino acids with tag, Predicted MWt 14.0kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 107 amino acids
Description : This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases.It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G.Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes; the protein is also thought to have broad-spectrum anti-biotic activity.
Conjugation : HIS
Molecular Weight : 14.000kDa
Tissue specificity : Mucous fluids.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA
Sequence Similarities : Contains 2 WAP domains.
Gene Name SLPI secretory leukocyte peptidase inhibitor [ Homo sapiens ]
Official Symbol SLPI
Synonyms SLPI; secretory leukocyte peptidase inhibitor; secretory leukocyte protease inhibitor (antileukoproteinase); antileukoproteinase; ALK1; ALP; BLPI; HUSI; HUSI I; WAP4; WFDC4;
Gene ID 6590
mRNA Refseq NM_003064
Protein Refseq NP_003055
MIM 107285
Uniprot ID P03973
Chromosome Location 20pter-p12.3
Function endopeptidase inhibitor activity; enzyme binding; protein binding; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLPI Products

Required fields are marked with *

My Review for All SLPI Products

Required fields are marked with *

0
cart-icon