Recombinant Human TARBP2, GST-tagged

Cat.No. : TARBP2-8473H
Product Overview : Recombinant Human TARBP2(1 a.a. - 366 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-366 a.a.
Description : HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene binds between the bulge and the loop of the HIV-1 TAR RNA regulatory element and activates HIV-1 gene expression in synergy with the viral Tat protein. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene also has a pseudogene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
AA Sequence : MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFRVTVGDTSCTG QGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAATPVPSVVLTRSPPMELQPP VSPQQSECNPVGALQELVVQKGWRLPEYTVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRV HTVPLDARDGNEVEPDDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLKIMAGSK
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name TARBP2 TAR (HIV-1) RNA binding protein 2 [ Homo sapiens ]
Official Symbol TARBP2
Synonyms LOQS; TRBP; TRBP1; TRBP2; RISC-loading complex subunit TARBP2; TAR (HIV) RNA binding protein 2; TAR (HIV) RNA-binding protein 2; TAR (HIV) RNA-binding protein TRBP1; TAR RNA binding protein 2; TAR RNA-binding protein 2; TARBP2; trans-activation responsive RNA-binding protein; trans-activation-responsive RNA-binding protein
Gene ID 6895
mRNA Refseq NM_134323
Protein Refseq NP_599150
MIM 605053
UniProt ID Q15633
Chromosome Location 12q13.13
Pathway Gene Expression, organism-specific biosystem; MicroRNA (miRNA) biogenesis, organism-specific biosystem; Small interfering RNA (siRNA) biogenesis, organism-specific biosystem
Function double-stranded RNA binding; miRNA binding; contributes_to pre-miRNA binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TARBP2 Products

Required fields are marked with *

My Review for All TARBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon