Recombinant Human TFEB protein, His-tagged
Cat.No. : | TFEB-6592H |
Product Overview : | Recombinant Human TFEB protein(P19484)(Glu221-Pro380), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Glu221-Pro380 |
Tag : | C-His |
Form : | Phosphate buffered saline. |
Molecular Mass : | 21 kDa |
Storage : | Store at -20°C to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAP |
Gene Name | TFEB transcription factor EB [ Homo sapiens ] |
Official Symbol | TFEB |
Synonyms | TFEB; transcription factor EB; bHLHe35; TCFEB; T-cell transcription factor EB; class E basic helix-loop-helix protein 35; BHLHE35; ALPHATFEB; |
Gene ID | 7942 |
mRNA Refseq | NM_001167827 |
Protein Refseq | NP_001161299 |
MIM | 600744 |
UniProt ID | P19484 |
◆ Recombinant Proteins | ||
TFEB-3202H | Recombinant Human TFEB, GST-tagged | +Inquiry |
TFEB-2611C | Recombinant Chicken TFEB | +Inquiry |
TFEB-6592H | Recombinant Human TFEB protein, His-tagged | +Inquiry |
TFEB-212H | Recombinant Human TFEB protein, T7/His-tagged | +Inquiry |
TFEB-12H | Recombinant Full Length Human transcription factor EB Protein, T7&His&TEV tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFEB-1128HCL | Recombinant Human TFEB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFEB Products
Required fields are marked with *
My Review for All TFEB Products
Required fields are marked with *