Recombinant Human TFEB protein, T7/His-tagged
| Cat.No. : | TFEB-212H | 
| Product Overview : | Recombinant human TFEB (475aa, Isoform-1. derived from BC032448) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 475 a.a. | 
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGFASRIGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQQQQLGGP PTPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASP GVRAGHVLSSSAGNSAPNSPMAMLHIGSNPERELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDP QVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWN KGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPSGMNMAELAQQVVKQ ELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHLDFSHSLSFGGREDEGPPGYPEPLAPGHGS PFPSLSKKDLDLMLLDDSLLPLASDPLLSTMSPEASKASSRRSSFSMEEGDVL | 
| Purity : | >90% by SDS-PAGE. | 
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. | 
| Gene Name | TFEB transcription factor EB [ Homo sapiens ] | 
| Official Symbol | TFEB | 
| Synonyms | TFEB; transcription factor EB; bHLHe35; TCFEB; T-cell transcription factor EB; BHLHE35; ALPHATFEB; | 
| Gene ID | 7942 | 
| mRNA Refseq | NM_001167827 | 
| Protein Refseq | NP_001161299 | 
| MIM | 600744 | 
| UniProt ID | P19484 | 
| Chromosome Location | 6p21 | 
| Function | DNA binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; transcription regulatory region DNA binding; transcription regulatory region DNA binding; | 
| ◆ Recombinant Proteins | ||
| TFEB-2611C | Recombinant Chicken TFEB | +Inquiry | 
| TFEB-14HFL | Recombinant Full Length Human transcription factor EB Protein, N-GST tagged | +Inquiry | 
| TFEB-4496R | Recombinant Rhesus Macaque TFEB Protein, His (Fc)-Avi-tagged | +Inquiry | 
| TFEB-3202H | Recombinant Human TFEB, GST-tagged | +Inquiry | 
| TFEB-12H | Recombinant Full Length Human transcription factor EB Protein, T7&His&TEV tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| TFEB-1128HCL | Recombinant Human TFEB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFEB Products
Required fields are marked with *
My Review for All TFEB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            