Recombinant Human TMED protein, GST-tagged
Cat.No. : | TMED-301467H |
Product Overview : | Recombinant Human TMED (27-89 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gly27-Ala89 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | GGAGPPPIQDGEFTFLLPAGRKQCFYQSAPANASLETEYQVIGGAGLDVDFTLESPQGVLLVSESRKA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | TMED1 transmembrane p24 trafficking protein 1 [ Homo sapiens (human) |
Official Symbol | TMED |
Synonyms | Tp24; p24g1; Il1rl1l; IL1RL1LG |
Gene ID | 11018 |
mRNA Refseq | NM_006858 |
Protein Refseq | NP_006849 |
MIM | 605395 |
UniProt ID | Q13445 |
◆ Recombinant Proteins | ||
TMED-301467H | Recombinant Human TMED protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TMED Products
Required fields are marked with *
My Review for All TMED Products
Required fields are marked with *