Recombinant Human TNFRSF10B, Fc-tagged

Cat.No. : TNFRSF10B-28127TH
Product Overview : Recombinant fragment corresponding to amino acids 56-182 of Human DR5 fused to the Fc region of human IgG1 expressed in modified human 293 cells, 40-50kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Fc
Protein Length : 56-182 a.a.
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces an apoptosis signal. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. Two transcript variants encoding different isoforms and one non-coding transcript have been found for this gene.
Conjugation : Fc
Tissue specificity : Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLa S3, K562, HL-60, SW480, A549 and G361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, p
Biological activity : The ED50 of DR5 Fc Chimera is typically 38-40 ng/ml as measured by its ability to neutralize TRAIL mediated cytotoxicity using the human leukemic Jurkat cells.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Shipped at 4°C. After reconstitution store at -20oC. Avoid freeze / thaw cycles.
Sequences of amino acids : Theoretical sequence:ITQQDLAPQQRAAPQQKRSSPSEGLCPPG HHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSG EVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGC PRGMVKVGDCTPWSDIECVHKEGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Sequence Similarities : Contains 1 death domain.Contains 3 TNFR-Cys repeats.
Gene Name TNFRSF10B tumor necrosis factor receptor superfamily, member 10b [ Homo sapiens ]
Official Symbol TNFRSF10B
Synonyms TNFRSF10B; tumor necrosis factor receptor superfamily, member 10b; tumor necrosis factor receptor superfamily member 10B; CD262; DR5; KILLER; TRAIL R2; TRICK2A; TRICKB;
Gene ID 8795
mRNA Refseq NM_003842
Protein Refseq NP_003833
MIM 603612
Uniprot ID O14763
Chromosome Location 8p22-p21
Pathway Activation of Pro-Caspase 8, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Apoptosis, organism-specific biosystem;
Function TRAIL binding; cysteine-type endopeptidase activator activity involved in apoptotic process; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF10B Products

Required fields are marked with *

My Review for All TNFRSF10B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon