Recombinant Human TREX2, His-tagged
Cat.No. : | TREX2-30121TH |
Product Overview : | Recombinant full length Human TREX2, isoform 2 with an N terminal His tag; 256aa, 28kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 236 amino acids |
Description : | This gene encodes a protein with 3 exonuclease activity. Enzymes with this activity are involved in DNA replication, repair, and recombination. Similarity to an E. coli protein suggests that this enzyme may be a subunit of DNA polymerase III, which does not have intrinsic exonuclease activity. |
Conjugation : | HIS |
Molecular Weight : | 28.000kDa inclusive of tags |
Tissue specificity : | Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA |
Sequence Similarities : | Belongs to the exonuclease superfamily. TREX family. |
Gene Name | TREX2 three prime repair exonuclease 2 [ Homo sapiens ] |
Official Symbol | TREX2 |
Synonyms | TREX2; three prime repair exonuclease 2; |
Gene ID | 11219 |
mRNA Refseq | NM_080701 |
Protein Refseq | NP_542432 |
MIM | 300370 |
Uniprot ID | Q9BQ50 |
Chromosome Location | Xq28 |
Function | 3-5-exodeoxyribonuclease activity; exodeoxyribonuclease III activity; exonuclease activity; hydrolase activity; nucleic acid binding; |
◆ Recombinant Proteins | ||
TREX2-965H | Recombinant Human TREX2, His-tagged | +Inquiry |
Trex2-6636M | Recombinant Mouse Trex2 Protein, Myc/DDK-tagged | +Inquiry |
TREX2-487H | Recombinant Human TREX2 Protein, His-tagged | +Inquiry |
TREX2-30121TH | Recombinant Human TREX2, His-tagged | +Inquiry |
TREX2-4316H | Recombinant Human TREX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREX2-802HCL | Recombinant Human TREX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TREX2 Products
Required fields are marked with *
My Review for All TREX2 Products
Required fields are marked with *
0
Inquiry Basket