Recombinant Human TREX2, His-tagged

Cat.No. : TREX2-30121TH
Product Overview : Recombinant full length Human TREX2, isoform 2 with an N terminal His tag; 256aa, 28kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 236 amino acids
Description : This gene encodes a protein with 3 exonuclease activity. Enzymes with this activity are involved in DNA replication, repair, and recombination. Similarity to an E. coli protein suggests that this enzyme may be a subunit of DNA polymerase III, which does not have intrinsic exonuclease activity.
Conjugation : HIS
Molecular Weight : 28.000kDa inclusive of tags
Tissue specificity : Detected in heart, breast, prostate, skeletal muscle, testis, uterus, bone marrow, colon, small intestine, stomach and thymus.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEA
Sequence Similarities : Belongs to the exonuclease superfamily. TREX family.
Gene Name TREX2 three prime repair exonuclease 2 [ Homo sapiens ]
Official Symbol TREX2
Synonyms TREX2; three prime repair exonuclease 2;
Gene ID 11219
mRNA Refseq NM_080701
Protein Refseq NP_542432
MIM 300370
Uniprot ID Q9BQ50
Chromosome Location Xq28
Function 3-5-exodeoxyribonuclease activity; exodeoxyribonuclease III activity; exonuclease activity; hydrolase activity; nucleic acid binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREX2 Products

Required fields are marked with *

My Review for All TREX2 Products

Required fields are marked with *

0
cart-icon