Recombinant Human TREX2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TREX2-4316H
Product Overview : TREX2 MS Standard C13 and N15-labeled recombinant protein (NP_542432) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a nuclear protein with 3' to 5' exonuclease activity. The encoded protein participates in double-stranded DNA break repair, and may interact with DNA polymerase delta.
Molecular Mass : 25.9 kDa
AA Sequence : MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TREX2 three prime repair exonuclease 2 [ Homo sapiens (human) ]
Official Symbol TREX2
Synonyms TREX2; three prime repair exonuclease 2; 3-5 exonuclease TREX2 long form;
Gene ID 11219
mRNA Refseq NM_080701
Protein Refseq NP_542432
MIM 300370
UniProt ID Q9BQ50

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TREX2 Products

Required fields are marked with *

My Review for All TREX2 Products

Required fields are marked with *

0
cart-icon