Recombinant Human TREX2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TREX2-4316H |
Product Overview : | TREX2 MS Standard C13 and N15-labeled recombinant protein (NP_542432) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a nuclear protein with 3' to 5' exonuclease activity. The encoded protein participates in double-stranded DNA break repair, and may interact with DNA polymerase delta. |
Molecular Mass : | 25.9 kDa |
AA Sequence : | MSEAPRAETFVFLDLEATGLPSVEPEIAELSLFAVHRSSLENPEHDESGALVLPRVLDKLTLCMCPERPFTAKASEITGLSSEGLARCRKAGFDGAVVRTLQAFLSRQAGPICLVAHNGFDYDFPLLCAELRRLGARLPRDTVCLDTLPALRGLDRAHSHGTRARGRQGYSLGSLFHRYFRAEPSAAHSAEGDVHTLLLIFLHRAAELLAWADEQARGWAHIEPMYLPPDDPSLEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TREX2 three prime repair exonuclease 2 [ Homo sapiens (human) ] |
Official Symbol | TREX2 |
Synonyms | TREX2; three prime repair exonuclease 2; 3-5 exonuclease TREX2 long form; |
Gene ID | 11219 |
mRNA Refseq | NM_080701 |
Protein Refseq | NP_542432 |
MIM | 300370 |
UniProt ID | Q9BQ50 |
◆ Recombinant Proteins | ||
Trex2-6636M | Recombinant Mouse Trex2 Protein, Myc/DDK-tagged | +Inquiry |
TREX2-4316H | Recombinant Human TREX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TREX2-487H | Recombinant Human TREX2 Protein, His-tagged | +Inquiry |
TREX2-965H | Recombinant Human TREX2, His-tagged | +Inquiry |
TREX2-30121TH | Recombinant Human TREX2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TREX2-802HCL | Recombinant Human TREX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TREX2 Products
Required fields are marked with *
My Review for All TREX2 Products
Required fields are marked with *
0
Inquiry Basket