Recombinant Human TSC22D3

Cat.No. : TSC22D3-29063TH
Product Overview : Recombinant fragment of Human GilZ / TilZ Isoform 2 with N-terminal proprietary tag.Mol Wt 36.3 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 97 amino acids
Description : The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene.
Molecular Weight : 36.300kDa inclusive of tags
Tissue specificity : Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT
Sequence Similarities : Belongs to the TSC-22/Dip/Bun family.
Gene Name TSC22D3 TSC22 domain family, member 3 [ Homo sapiens ]
Official Symbol TSC22D3
Synonyms TSC22D3; TSC22 domain family, member 3; delta sleep inducing peptide, immunoreactor , DSIPI; TSC22 domain family protein 3; DIP; GILZ; glucocorticoid induced leucine zipper; hDIP; TSC 22R;
Gene ID 1831
mRNA Refseq NM_001015881
Protein Refseq NP_001015881
MIM 300506
Uniprot ID Q99576
Chromosome Location Xq22.3
Function MyoD binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TSC22D3 Products

Required fields are marked with *

My Review for All TSC22D3 Products

Required fields are marked with *

0
cart-icon
0
compare icon