Recombinant Human TSC22D3
Cat.No. : | TSC22D3-29063TH |
Product Overview : | Recombinant fragment of Human GilZ / TilZ Isoform 2 with N-terminal proprietary tag.Mol Wt 36.3 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 97 amino acids |
Description : | The protein encoded by this gene shares significant sequence identity with the murine TSC-22 and Drosophila shs, both of which are leucine zipper proteins, that function as transcriptional regulators. The expression of this gene is stimulated by glucocorticoids and interleukin 10, and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid and chemokine. Transcript variants encoding different isoforms have been identified for this gene. |
Molecular Weight : | 36.300kDa inclusive of tags |
Tissue specificity : | Expressed in brain, lung, spleen and skeletal muscle. Lower levels detected in heart and kidney. Not detected in the pancreas. In non-lymphoid tissues, in the absence of inflammation, the major source of constitutive expression is the macrophage lineage. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAQSKLDCRSPVGLDCCNCCLDLAHRSGLQRGSSGENNNPGSPTVSNFRQLQEKLVFENLNTDKLNSIMRQDSLEPVLRDPCYLINEGICNRNIDQT |
Sequence Similarities : | Belongs to the TSC-22/Dip/Bun family. |
Gene Name | TSC22D3 TSC22 domain family, member 3 [ Homo sapiens ] |
Official Symbol | TSC22D3 |
Synonyms | TSC22D3; TSC22 domain family, member 3; delta sleep inducing peptide, immunoreactor , DSIPI; TSC22 domain family protein 3; DIP; GILZ; glucocorticoid induced leucine zipper; hDIP; TSC 22R; |
Gene ID | 1831 |
mRNA Refseq | NM_001015881 |
Protein Refseq | NP_001015881 |
MIM | 300506 |
Uniprot ID | Q99576 |
Chromosome Location | Xq22.3 |
Function | MyoD binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
TSC22D3-17477M | Recombinant Mouse TSC22D3 Protein | +Inquiry |
TSC22D3-4989R | Recombinant Rhesus monkey TSC22D3 Protein, His-tagged | +Inquiry |
TSC22D3-3512C | Recombinant Chicken TSC22D3 | +Inquiry |
TSC22D3-7192H | Recombinant Human TSC22 Domain Family, Member 3, His-tagged | +Inquiry |
TSC22D3-531HF | Recombinant Full Length Human TSC22D3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSC22D3-723HCL | Recombinant Human TSC22D3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TSC22D3 Products
Required fields are marked with *
My Review for All TSC22D3 Products
Required fields are marked with *
0
Inquiry Basket