Recombinant Human UBE2D2
Cat.No. : | UBE2D2-30042TH |
Product Overview : | Tagged Recombinant Human UBE2D2. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM HEPES, 100mM Sodium chloride, pH 8 |
Storage : | Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | The sequence (minus the tag) is:MALKRIHKELNDLARDPPAQCSAGPVGDDMFHW QATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTT RIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLC DPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM |
Sequence Similarities : | Belongs to the ubiquitin-conjugating enzyme family. |
Gene Name | UBE2D2 ubiquitin-conjugating enzyme E2D 2 [ Homo sapiens ] |
Official Symbol | UBE2D2 |
Synonyms | UBE2D2; ubiquitin-conjugating enzyme E2D 2; ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5) , ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog, yeast); ubiquitin-conjugating enzyme E2 D2; UBC4; UbcH5B; |
Gene ID | 7322 |
mRNA Refseq | NM_003339 |
Protein Refseq | NP_003330 |
MIM | 602962 |
Uniprot ID | P62837 |
Chromosome Location | 5q31.3 |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | ATP binding; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
UBE2D2-6052R | Recombinant Rat UBE2D2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2D2-301587H | Recombinant Human UBE2D2 protein, GST-tagged | +Inquiry |
UBE2D2-31647TH | Recombinant Human UBE2D2, His-tagged | +Inquiry |
UBE2D2-30042TH | Recombinant Human UBE2D2 | +Inquiry |
UBE2D2-37H | Recombinant Human UBE2D2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D2-587HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
UBE2D2-588HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2D2 Products
Required fields are marked with *
My Review for All UBE2D2 Products
Required fields are marked with *
0
Inquiry Basket