Recombinant Human WDR5, His-tagged
| Cat.No. : | WDR5-31543TH |
| Product Overview : | Recombinant full length Human WDR5 with an N terminal His tag; single, non-glycosylated polypeptide chain; 354 amino acids including tag, MWt 38.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 334 amino acids |
| Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. |
| Conjugation : | HIS |
| Molecular Weight : | 38.800kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.03% DTT, 0.58% Sodium chloride, 0.24% Tris |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPS SSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV KFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH TDVVISTACHPTENIIASAALENDKTIKLWKSDC |
| Sequence Similarities : | Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats. |
| Gene Name | WDR5 WD repeat domain 5 [ Homo sapiens ] |
| Official Symbol | WDR5 |
| Synonyms | WDR5; WD repeat domain 5; WD repeat-containing protein 5; SWD3; Set1c WD40 repeat protein; homolog (S. cerevisiae); |
| Gene ID | 11091 |
| mRNA Refseq | NM_017588 |
| Protein Refseq | NP_060058 |
| MIM | 609012 |
| Uniprot ID | P61964 |
| Chromosome Location | 9q34 |
| Pathway | Circadian rhythm pathway, organism-specific biosystem; |
| Function | contributes_to histone methyltransferase activity (H3-K4 specific); protein binding; |
| ◆ Recombinant Proteins | ||
| WDR5-007H | Recombinant Human WDR5 Protein | +Inquiry |
| WDR5-3718H | Recombinant Human WDR5, GST-tagged | +Inquiry |
| WDR5-6871HF | Recombinant Full Length Human WDR5 Protein, GST-tagged | +Inquiry |
| WDR5-2734H | Recombinant Human WD Repeat Domain 5, His-tagged | +Inquiry |
| WDR5-6225R | Recombinant Rat WDR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WDR5-344HCL | Recombinant Human WDR5 293 Cell Lysate | +Inquiry |
| WDR5-343HCL | Recombinant Human WDR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WDR5 Products
Required fields are marked with *
My Review for All WDR5 Products
Required fields are marked with *
