Recombinant Human WDR5, His-tagged

• Cat.No.: WDR5-31543TH
• Product Overview: Recombinant full length Human WDR5 with an N terminal His tag; single, non-glycosylated polypeptide chain; 354 amino acids including tag, MWt 38.8 kDa.

Specification

• Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.
• Protein length: 334 amino acids
• Conjugation: HIS
• Molecular Weight: 38.800kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.03% DTT, 0.58% Sodium chloride, 0.24% Tris
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPS SSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV KFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH TDVVISTACHPTENIIASAALENDKTIKLWKSDC
• Sequence Similarities: Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats.

Gene Information

• Gene Name: WDR5 WD repeat domain 5 [ Homo sapiens ]
• Official Symbol: WDR5
• Synonyms: WDR5; WD repeat domain 5; WD repeat-containing protein 5; SWD3; Set1c WD40 repeat protein; homolog (S. cerevisiae)
• Gene ID: 11091
• mRNA Refseq: NM_017588
• Protein Refseq: NP_060058
• MIM: 609012
• Uniprot ID: P61964
• Chromosome Location: 9q34
• Pathway: Circadian rhythm pathway, organism-specific biosystem
• Function: contributes_to histone methyltransferase activity (H3-K4 specific); protein binding

Reviews

11/25/2020

Their ability to accommodate the requirements of large-scale experiments and guarantee a reliable supply streamlines my research operations, eliminating any concerns related to potential shortages.

10/10/2020

I am confident that the protein will reliably perform in my assays, providing accurate and reproducible results.

09/25/2017

the manufacturer's supply management capabilities assure a seamless and continuous provision of the WDR5 protein.

Q&As

Can WDR5 play a role in non-cancerous diseases?

Yes, WDR5 has been associated with neurodevelopmental disorders, suggesting a role in non-cancerous diseases as well.

How does WDR5 affect neurodevelopment?

WDR5 regulates the expression of genes critical for neural development, and dysregulation can lead to developmental disorders.

How can WDR5 be used as a diagnostic marker for cancer?

Elevated levels of WDR5 in certain cancers can serve as a diagnostic marker when detected in patient samples.

Are there any clinical trials involving WDR5-targeted therapies?

Yes, there are ongoing clinical trials to test the safety and efficacy of WDR5-targeted therapies in cancer patients.

Is there a connection between WDR5 and autoimmune diseases?

Some studies suggest a potential link between WDR5 and autoimmune diseases, but further research is needed to confirm this association.