Recombinant Human WDR5, His-tagged
Cat.No. : | WDR5-31543TH |
Product Overview : | Recombinant full length Human WDR5 with an N terminal His tag; single, non-glycosylated polypeptide chain; 354 amino acids including tag, MWt 38.8 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 334 amino acids |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. |
Conjugation : | HIS |
Molecular Weight : | 38.800kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.03% DTT, 0.58% Sodium chloride, 0.24% Tris |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPS SSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV KFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH TDVVISTACHPTENIIASAALENDKTIKLWKSDC |
Sequence Similarities : | Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats. |
Gene Name | WDR5 WD repeat domain 5 [ Homo sapiens ] |
Official Symbol | WDR5 |
Synonyms | WDR5; WD repeat domain 5; WD repeat-containing protein 5; SWD3; Set1c WD40 repeat protein; homolog (S. cerevisiae); |
Gene ID | 11091 |
mRNA Refseq | NM_017588 |
Protein Refseq | NP_060058 |
MIM | 609012 |
Uniprot ID | P61964 |
Chromosome Location | 9q34 |
Pathway | Circadian rhythm pathway, organism-specific biosystem; |
Function | contributes_to histone methyltransferase activity (H3-K4 specific); protein binding; |
◆ Recombinant Proteins | ||
WDR5-31543TH | Recombinant Human WDR5, His-tagged | +Inquiry |
WDR5-3718H | Recombinant Human WDR5, GST-tagged | +Inquiry |
WDR5-6569R | Recombinant Rat WDR5 Protein | +Inquiry |
WDR5-6225R | Recombinant Rat WDR5 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR5-12323Z | Recombinant Zebrafish WDR5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR5-344HCL | Recombinant Human WDR5 293 Cell Lysate | +Inquiry |
WDR5-343HCL | Recombinant Human WDR5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR5 Products
Required fields are marked with *
My Review for All WDR5 Products
Required fields are marked with *
0
Inquiry Basket