Recombinant Human ANXA5 Protein, His-tagged
| Cat.No. : | ANXA5-1124H |
| Product Overview : | Recombinant Human ANXA5 Protein (2-320aa) was expressed in yeast with N-terminal 6His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-320 a.a. |
| Description : | This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 37.8 kDa |
| AA Sequence : | AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | ANXA5 annexin A5 [ Homo sapiens ] |
| Official Symbol | ANXA5 |
| Synonyms | ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2 |
| Gene ID | 308 |
| mRNA Refseq | NM_001154 |
| Protein Refseq | NP_001145 |
| MIM | 131230 |
| UniProt ID | P08758 |
| ◆ Recombinant Proteins | ||
| ANXA5-1124H | Recombinant Human ANXA5 Protein, His-tagged | +Inquiry |
| ANXA5-4705H | Recombinant Human ANXA5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ANXA5-48C | Recombinant Cynomolgus Monkey ANXA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ANXA5-2606H | Recombinant Human ANXA5 protein(11-200 aa), C-His-tagged | +Inquiry |
| Anxa5-609M | Recombinant Mouse Anxa5 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ANXA5-038HKCL | Human ANXA5 Knockdown Cell Lysate | +Inquiry |
| ANXA5-8830HCL | Recombinant Human ANXA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANXA5 Products
Required fields are marked with *
My Review for All ANXA5 Products
Required fields are marked with *



