Recombinant Human ANXA5 Protein, His-tagged

• Cat.No.: ANXA5-1124H
• Product Overview: Recombinant Human ANXA5 Protein (2-320aa) was expressed in yeast with N-terminal 6His tag.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 2-320 a.a.
• Description: This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 37.8 kDa
• AA Sequence: AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: ANXA5 annexin A5 [ Homo sapiens ]
• Official Symbol: ANXA5
• Synonyms: ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2
• Gene ID: 308
• mRNA Refseq: NM_001154
• Protein Refseq: NP_001145
• MIM: 131230
• UniProt ID: P08758