Cat.No. :	ANXA5-1124H
Product Overview :	Recombinant Human ANXA5 Protein (2-320aa) was expressed in yeast with N-terminal 6His tag.
Description :	This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Source :	Yeast
Species :	Human
Tag :	His
Form :	Tris-based buffer, 50% glycerol.
Molecular Mass :	37.8 kDa
AA Sequence :	AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name :	ANXA5 annexin A5 [ Homo sapiens ]
Official Symbol :	ANXA5
Synonyms :	ANXA5; annexin A5; ANX5, ENX2; CBP-I; PAP-I; VAC-alpha; annexin V; annexin-5; anchorin CII; endonexin II; lipocortin V; calphobindin I; thromboplastin inhibitor; vascular anticoagulant-alpha; placental anticoagulant protein 4; placental anticoagulant protein I; PP4; ANX5; ENX2
Gene ID :	308
mRNA Refseq :	NM_001154
Protein Refseq :	NP_001145
MIM :	131230
UniProt ID :	P08758

Online Inquiry