Recombinant Mouse Ccl17 protein

Cat.No. : Ccl17-622M
Product Overview : Recombinant Mouse Ccl17 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 70
Description : Murine CCL17 also known as TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine and SCYA17, is encoded by the CCL17 gene located on the chromosome 8. Among CC chemokine family members, CCL17 has approximately 24 – 29 % amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309. CCL17 is a secreted protein and expressed by thymus cells constitutively and phytohemagglutinin-stimulated peripheral blood mononuclear cells transiently. It signals through the chemokine receptors CCR4 and CCR8 and displays chemotactic activity for T lymphocytes and some other leukocytes. CCL17 play an important role in skin diseases such as atopic dermatitis, bullous pemphigoid and mycosis fungoides.Recombinant CCL17 has been shown to be chemotactic for T cell lines but not monocytes or neutrophils.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids.
AA Sequence : ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP
Endotoxin : Less than 1 EU/µg of rMuTARC/CCL17 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl17
Official Symbol Ccl17
Synonyms CCL17; chemokine (C-C motif) ligand 17; small inducible cytokine subfamily A17; Tarc; Abcd-2; Scya17; Scya17l;
Gene ID 20295
mRNA Refseq NM_011332
Protein Refseq NP_035462
UniProt ID F6R5P4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl17 Products

Required fields are marked with *

My Review for All Ccl17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon