Species : |
Mouse |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
70 |
Description : |
Murine CCL17 also known as TARC, Small-inducible cytokine A17, Thymus and activation-regulated chemokine and SCYA17, is encoded by the CCL17 gene located on the chromosome 8. Among CC chemokine family members, CCL17 has approximately 24 – 29 % amino acid sequence identity with RANTES, MIP-1α, MIP-1β, MCP-1, MCP-2, MCP-3 and I-309. CCL17 is a secreted protein and expressed by thymus cells constitutively and phytohemagglutinin-stimulated peripheral blood mononuclear cells transiently. It signals through the chemokine receptors CCR4 and CCR8 and displays chemotactic activity for T lymphocytes and some other leukocytes. CCL17 play an important role in skin diseases such as atopic dermatitis, bullous pemphigoid and mycosis fungoides.Recombinant CCL17 has been shown to be chemotactic for T cell lines but not monocytes or neutrophils. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The biologically active determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml. |
Molecular Mass : |
Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 70 amino acids. |
AA Sequence : |
ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP |
Endotoxin : |
Less than 1 EU/µg of rMuTARC/CCL17 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |