Recombinant Human CCL17 Protein, GST-Tagged

Cat.No. : CCL17-0614H
Product Overview : Human CCL17 partial ORF (NP_002978, 24 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014]
Molecular Mass : 33.55 kDa
AA Sequence : ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ]
Official Symbol CCL17
Synonyms CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273;
Gene ID 6361
mRNA Refseq NM_002987
Protein Refseq NP_002978
MIM 601520
UniProt ID Q92583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL17 Products

Required fields are marked with *

My Review for All CCL17 Products

Required fields are marked with *

0
cart-icon