Recombinant Human CCL17 Protein, GST-Tagged
Cat.No. : | CCL17-0614H |
Product Overview : | Human CCL17 partial ORF (NP_002978, 24 a.a. - 94 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This antimicrobial gene is one of several Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 16. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for T lymphocytes, but not monocytes or granulocytes. The product of this gene binds to chemokine receptors CCR4 and CCR8. This chemokine plays important roles in T cell development in thymus as well as in trafficking and activation of mature T cells. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 33.55 kDa |
AA Sequence : | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CCL17 chemokine (C-C motif) ligand 17 [ Homo sapiens ] |
Official Symbol | CCL17 |
Synonyms | CCL17; chemokine (C-C motif) ligand 17; SCYA17, small inducible cytokine subfamily A (Cys Cys), member 17; C-C motif chemokine 17; ABCD 2; TARC; CC chemokine TARC; T cell-directed CC chemokine; small-inducible cytokine A17; thymus and activation-regulated chemokine; small inducible cytokine subfamily A (Cys-Cys), member 17; ABCD-2; SCYA17; A-152E5.3; MGC138271; MGC138273; |
Gene ID | 6361 |
mRNA Refseq | NM_002987 |
Protein Refseq | NP_002978 |
MIM | 601520 |
UniProt ID | Q92583 |
◆ Recombinant Proteins | ||
CCL17-41H | Recombinant Human CCL17 Protein | +Inquiry |
CCL17-10H | Recombinant Human CCL17 Protein | +Inquiry |
CCL17-8818C | Recombinant Cynomolgus CCL17, His tagged | +Inquiry |
CCL17-0265H | Recombinant Human CCL17 protein, His-tagged | +Inquiry |
CCL17-6432D | Recombinant Dog CCL17 protein(24-99aa), MBP&His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL17-001CCL | Recombinant Cynomolgus CCL17 cell lysate | +Inquiry |
CCL17-535MCL | Recombinant Mouse CCL17 cell lysate | +Inquiry |
CCL17-588HCL | Recombinant Human CCL17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL17 Products
Required fields are marked with *
My Review for All CCL17 Products
Required fields are marked with *