Recombinant Mouse Ccl2 Protein, His-tagged
Cat.No. : | Ccl2-7335M |
Product Overview : | Recombinant mouse CCL2 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-148 |
Description : | This gene is one of several cytokine genes clustered on chromosome 11. Chemokines are a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of N-terminal cysteine residues of the mature peptide. This chemokine is a member of the CC subfamily which is characterized by two adjacent cysteine residues. This cytokine displays chemotactic activity for monocytes and memory T cells but not for neutrophils. The human ortholog has been implicated in the pathogenesis of diseases characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis, and atherosclerosis. |
Form : | Liquid |
Molecular Mass : | 16 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : | In PBS (pH 7.4) containing 10 % glycerol. |
Gene Name | Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus (house mouse) ] |
Official Symbol | Ccl2 |
Synonyms | Ccl2; chemokine (C-C motif) ligand 2; JE; MCA; MCP; Scy; Sig; HC11; MCAF; MCP-; MCP1; MCP-1; SMC-C; Scya2; Sigje; SMC-CF; AI323594; C-C motif chemokine 2; monocyte chemoattractant protein 1; monocyte chemotactic protein 1; platelet-derived growth factor-inducible protein JE; small-inducible cytokine A2 |
Gene ID | 20296 |
mRNA Refseq | NM_011333 |
Protein Refseq | NP_035463 |
UniProt ID | P10148 |
◆ Recombinant Proteins | ||
Ccl2-687M | Recombinant Mouse Ccl2 protein, His-tagged | +Inquiry |
CCL2-2649H | Recombinant Human CCL2 protein, GST-tagged | +Inquiry |
CCL2-2147P | Recombinant Pig CCL2 Protein, His-tagged | +Inquiry |
Ccl2-75M | Active Recombinant Mouse Ccl2 Protein (Gln24-Ala127), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CCL2-1102C | Recombinant Cattle CCL2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL2-001MCL | Recombinant Mouse CCL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl2 Products
Required fields are marked with *
My Review for All Ccl2 Products
Required fields are marked with *
0
Inquiry Basket