Recombinant Mouse Col18a1 protein, H1591-K1774, C-6×His tagged
Cat.No. : | Col18a1-12M |
Product Overview : | Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1 (XVIII) chain/COL18A1 protein, expressed by HEK293, with C-6×His labeled tag. The total length of Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is 184 AA. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | H1591-K1774 |
Description : | Predicted to enable identical protein binding activity. Predicted to be an extracellular matrix structural constituent. Acts upstream of or within several processes, including angiogenesis; endothelial cell morphogenesis; and positive regulation of endothelial cell apoptotic process. Located in basement membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and sensory organ. Used to study pigment dispersion syndrome. Human ortholog(s) of this gene implicated in primary angle-closure glaucoma. Orthologous to human COL18A1 (collagen type XVIII alpha 1 chain). |
Form : | Lyophilized powder |
Molecular Mass : | Approximately 18.0 kDa |
AA Sequence : | HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK |
Endotoxin : | <1 EU/μg determined by LAL method. |
Purity : | > 95% by SDS-PAGE |
Storage : | Stored at -20 centigrade for 2 years. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 centigrade or -80 centigrade for extended storage. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
Reconstitution : | It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose). |
Gene Name | Col18a1 collagen, type XVIII, alpha 1 [ Mus musculus (house mouse) ] |
Official Symbol | Col18a1 |
Synonyms | Col18a1; collagen, type XVIII, alpha 1; collagen alpha-1(XVIII) chain; alpha-1(XVIII) collagen; endostatin; procollagen, type XVIII, alpha 1 |
Gene ID | 12822 |
mRNA Refseq | NM_009929 |
Protein Refseq | NP_034059 |
UniProt ID | P39061 |
◆ Recombinant Proteins | ||
COL18A1-807H | Active Recombinant Human COL18A1 | +Inquiry |
COL18A1-326H | Recombinant Human COL18A1 Protein, His-tagged | +Inquiry |
COL18A1-3634Z | Recombinant Zebrafish COL18A1 | +Inquiry |
COL18A1-5739C | Recombinant Chicken COL18A1 | +Inquiry |
COL18A1-3722M | Recombinant Mouse COL18A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Col18a1 Products
Required fields are marked with *
My Review for All Col18a1 Products
Required fields are marked with *
0
Inquiry Basket