Recombinant Mouse Col18a1 protein, H1591-K1774, C-6×His tagged

• Cat.No.: Col18a1-12M
• Product Overview: Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Collagen alpha-1 (XVIII) chain/COL18A1 protein, expressed by HEK293, with C-6×His labeled tag. The total length of Collagen alpha-1 (XVIII) chain/COL18A1 Protein, Mouse (HEK293, His) is 184 AA.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: H1591-K1774
• Description: Predicted to enable identical protein binding activity. Predicted to be an extracellular matrix structural constituent. Acts upstream of or within several processes, including angiogenesis; endothelial cell morphogenesis; and positive regulation of endothelial cell apoptotic process. Located in basement membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and sensory organ. Used to study pigment dispersion syndrome. Human ortholog(s) of this gene implicated in primary angle-closure glaucoma. Orthologous to human COL18A1 (collagen type XVIII alpha 1 chain).
• Form: Lyophilized powder
• Molecular Mass: Approximately 18.0 kDa
• AA Sequence: HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK
• Endotoxin: <1 EU/μg determined by LAL method.
• Purity: > 95% by SDS-PAGE
• Storage: Stored at -20 centigrade for 2 years. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 centigrade or -80 centigrade for extended storage.
• Storage Buffer: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Gene Information

• Gene Name: Col18a1 collagen, type XVIII, alpha 1 [ Mus musculus (house mouse) ]
• Official Symbol: Col18a1
• Synonyms: Col18a1; collagen, type XVIII, alpha 1; collagen alpha-1(XVIII) chain; alpha-1(XVIII) collagen; endostatin; procollagen, type XVIII, alpha 1
• Gene ID: 12822
• mRNA Refseq: NM_009929
• Protein Refseq: NP_034059
• UniProt ID: P39061