Species : |
Mouse |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
H1591-K1774 |
Description : |
Predicted to enable identical protein binding activity. Predicted to be an extracellular matrix structural constituent. Acts upstream of or within several processes, including angiogenesis; endothelial cell morphogenesis; and positive regulation of endothelial cell apoptotic process. Located in basement membrane. Is expressed in several structures, including alimentary system; brain; genitourinary system; respiratory system; and sensory organ. Used to study pigment dispersion syndrome. Human ortholog(s) of this gene implicated in primary angle-closure glaucoma. Orthologous to human COL18A1 (collagen type XVIII alpha 1 chain). |
Form : |
Lyophilized powder |
Molecular Mass : |
Approximately 18.0 kDa |
AA Sequence : |
HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENSFMTSFSK |
Endotoxin : |
<1 EU/μg determined by LAL method. |
Purity : |
> 95% by SDS-PAGE |
Storage : |
Stored at -20 centigrade for 2 years. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 centigrade or -80 centigrade for extended storage. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
Reconstitution : |
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose). |