Active Recombinant Human COL18A1 Protein (184 aa)

Cat.No. : COL18A1-159C
Product Overview : Recombinant Endostatin expressed in yeast, whichcauses G1 arrest of endothelial cells. Endostatin treatment results in apoptosis of HUVE and HMVE cells. Recombinant human Endostatin is a 20.2 kDa protein consisting of 184 amino acid residues.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Protein Length : 184
Description : Endostatin is a cleaved product of the carboxyl-terminal domain of collagen XVIII. It functions as an anti-angiogenic cytokine that is expressed in various organs especially with high levels in liver, lung, and kidney. Endostatin inhibits angiogenesis by blocking the pro-angiogenic activities of VEGF and FGF-basic.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Determined by Endothelial Cell Tube Formation. The cells treated with 10 μg/mL Endostatin showed significant anti-angiogenesis effect.
Molecular Mass : ~20.2 kDa, observed by reducing SDS-PAGE.
AA Sequence : AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Endotoxin : Endotoxin level is less than 0.1 ng/μg (1 EU/μg) of Endostatin.
Purity : Greater than 97% by SDS-PAGE
Storage : The lyophilized Endostatin is stable for a few weeks at room temperature, but best stored at -20 centigrade. For the first use, reconstitute in water, aliquot and store at -20 centigrade to avoid multiple freeze-thaws.
Storage Buffer : The sterile filtered solution was lyophilized with 17 mM citric-phosphate buffer, pH 6.2.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name COL18A1 collagen, type XVIII, alpha 1 [ Homo sapiens ]
Official Symbol COL18A1
Synonyms COL18A1; collagen, type XVIII, alpha 1; KNO, Knobloch syndrome, type 1; collagen alpha-1(XVIII) chain; endostatin; KNO1; KS; antiangiogenic agent; multi-functional protein MFP; KNO; FLJ27325; FLJ34914; MGC74745;
Gene ID 80781
mRNA Refseq NM_030582
Protein Refseq NP_085059
MIM 120328
UniProt ID P39060

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL18A1 Products

Required fields are marked with *

My Review for All COL18A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon