Active Recombinant Human COL18A1 Protein (184 aa)
Cat.No. : | COL18A1-159C |
Product Overview : | Recombinant Endostatin expressed in yeast, whichcauses G1 arrest of endothelial cells. Endostatin treatment results in apoptosis of HUVE and HMVE cells. Recombinant human Endostatin is a 20.2 kDa protein consisting of 184 amino acid residues. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Protein Length : | 184 |
Description : | Endostatin is a cleaved product of the carboxyl-terminal domain of collagen XVIII. It functions as an anti-angiogenic cytokine that is expressed in various organs especially with high levels in liver, lung, and kidney. Endostatin inhibits angiogenesis by blocking the pro-angiogenic activities of VEGF and FGF-basic. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by Endothelial Cell Tube Formation. The cells treated with 10 μg/mL Endostatin showed significant anti-angiogenesis effect. |
Molecular Mass : | ~20.2 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK |
Endotoxin : | Endotoxin level is less than 0.1 ng/μg (1 EU/μg) of Endostatin. |
Purity : | Greater than 97% by SDS-PAGE |
Storage : | The lyophilized Endostatin is stable for a few weeks at room temperature, but best stored at -20 centigrade. For the first use, reconstitute in water, aliquot and store at -20 centigrade to avoid multiple freeze-thaws. |
Storage Buffer : | The sterile filtered solution was lyophilized with 17 mM citric-phosphate buffer, pH 6.2. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | COL18A1 collagen, type XVIII, alpha 1 [ Homo sapiens ] |
Official Symbol | COL18A1 |
Synonyms | COL18A1; collagen, type XVIII, alpha 1; KNO, Knobloch syndrome, type 1; collagen alpha-1(XVIII) chain; endostatin; KNO1; KS; antiangiogenic agent; multi-functional protein MFP; KNO; FLJ27325; FLJ34914; MGC74745; |
Gene ID | 80781 |
mRNA Refseq | NM_030582 |
Protein Refseq | NP_085059 |
MIM | 120328 |
UniProt ID | P39060 |
◆ Recombinant Proteins | ||
COL18A1-4986H | Recombinant Human Collagen, Type XVIII, Alpha 1 | +Inquiry |
Col18a1-199M | Recombinant Murine Collagen, Type XVIII, Alpha 1 | +Inquiry |
Col18a1-204M | Recombinant Mouse Collagen, Type XVIII, Alpha 1 | +Inquiry |
Col18a1-205M | Active Recombinant Mouse Col18a1, His-tagged | +Inquiry |
Col18a1-327M | Recombinant Mouse Col18a1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL18A1 Products
Required fields are marked with *
My Review for All COL18A1 Products
Required fields are marked with *