"COL18A1" Related Products

Expand
Expand
Expand

Recombinant Human COL18A1 Protein (1578-1754 aa), His-tagged

Cat.No. : COL18A1-1367H
Product Overview : Recombinant Human COL18A1 Protein (1578-1754 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Adhesion. Protein Description: Partial.
Description : COLA18A probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.Endostatin potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling.
Source : Yeast
Species : Human
Tag : His
Form : Tris-based buffer,50% glycerol
Molecular Mass : 21.3 kDa
Protein length : 1578-1754 aa
AA Sequence : QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Figure :

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Gene Name : COL18A1 collagen, type XVIII, alpha 1 [ Homo sapiens ]
Official Symbol : COL18A1
Synonyms : COL18A1; KNO1; KS; KNO; FLJ27325; FLJ34914; MGC74745;
Gene ID : 80781
mRNA Refseq : NM_030582
Protein Refseq : NP_085059
MIM : 120328
UniProt ID : P39060

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.