Recombinant Mouse Ctla4 Protein, hIgG-His-tagged

Cat.No. : Ctla4-7168M
Product Overview : Recombinant Mouse Ctla4 Protein with hIgG-His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Tag : Fc&His
Protein Length : 38-161
Description : This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Form : Liquid
Molecular Mass : 40.6 kDa
AA Sequence : IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ]
Official Symbol Ctla4
Synonyms Ctla4; cytotoxic T-lymphocyte-associated protein 4; Ctla; Ly-5; Cd152; Ly-56; Ctla-4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4
Gene ID 12477
mRNA Refseq NM_001281976
Protein Refseq NP_001268905
UniProt ID Q5SSM0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ctla4 Products

Required fields are marked with *

My Review for All Ctla4 Products

Required fields are marked with *

0
cart-icon