Recombinant Mouse Cxcl1 protein

Cat.No. : Cxcl1-96M
Product Overview : Recombinant Mouse Cxcl1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 72
Description : Murine CXCL1, also known as KC, is belonging to the CXC chemokine family. It is encoded by the GRO gene now designated CXCL1. The gene for CXCL1 was initially discovered in mouse fibroblasts by plateletderived growth factor. KC is member of the intercrine alpha (chemokine C-X-C) subfamily of chemokines. It is secreted by human melanoma cells, and also expressed by macrophages, neutrophils and epithelial cells. The functional receptor for CXCL1 has been identified as CXCR2. CXCL1 has chemotactic activity for neutrophils, and plays a role in inflammation and wound healing. Amino acid sequence of murine CXCL1 is approximately 60 % identical to the human CXCL1. KC was found to be involved in monocyte arrest on atherosclerotic endothelium and may also play a pathophysiological role in Alzheimer’s disease.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 72 amino acid residues.
AA Sequence : APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
Endotoxin : Less than 1 EU/μg of rMuKC/CXCL1 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Cxcl1
Official Symbol Cxcl1
Synonyms CXCL1; chemokine (C-X-C motif) ligand 1; growth-regulated alpha protein; KC/GR)-alpha; KC/GRO-alpha; GRO1 oncogene; secretory protein N51; C-X-C motif chemokine 1; platelet-derived growth factor-inducible protein KC; KC; Fsp; N51; gro; Gro1; Mgsa; Scyb1;
Gene ID 14825
mRNA Refseq NM_008176
Protein Refseq NP_032202
UniProt ID P12850

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl1 Products

Required fields are marked with *

My Review for All Cxcl1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon