Active Recombinant Mouse Cxcl2 Protein
Cat.No. : | Cxcl2-2395M |
Product Overview : | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 2 (Cxcl2) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. |
Bio-activity : | Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL. |
Molecular Mass : | 7.8 kDa |
AA Sequence : | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus (house mouse) ] |
Official Symbol | Cxcl2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a |
Gene ID | 20310 |
mRNA Refseq | NM_009140 |
Protein Refseq | NP_033166 |
UniProt ID | P10889 |
◆ Recombinant Proteins | ||
Cxcl2-010C | Active Recombinant Rat Cxcl2 Protein (73 aa) | +Inquiry |
Cxcl2-626R | Active Recombinant Rat Cxcl2 | +Inquiry |
Cxcl2-328C | Active Recombinant Mouse Cxcl2 Protein (73 aa) | +Inquiry |
Cxcl2-1070R | Recombinant Rat Cxcl2 protein | +Inquiry |
Cxcl2-5249M | Recombinant Mouse Cxcl2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl2 Products
Required fields are marked with *
My Review for All Cxcl2 Products
Required fields are marked with *
0
Inquiry Basket