Active Recombinant Rat Cxcl2 Protein (73 aa)
Cat.No. : | Cxcl2-010C |
Product Overview : | Recombinant Rat Cxcl2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 73 |
Description : | Rat GRO-beta/MIP-2/CXCL2 has been found to be expressed by cytokine stimulated rat alveolar macrophages and fibroblasts. Based on its protein and DNA sequences, GRO-beta/MIP-2 is a member of the alpha (CXC) subfamily of chemokines. The protein sequence of rat GRO-beta/MIP-2 shares approximately 88% identity with murine MIP2. Characteristic of ELR containing CXC chemokines, GRO-beta/MIP-2 is known to be a potent chemotactic factor for rat neutrophils in vitro and in vivo. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg. |
Molecular Mass : | 7.9 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : | VVVASELRCQCLTTLPRVDFKNIQSLTVTPPGPHCAQTEVIATLKDGHEVCLNPEAPLVQRIVQKILNKGKAN |
Endotoxin : | Less than 1 EU/μg of rRtMIP-2/CXCL2 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Cxcl2 chemokine (C-X-C motif) ligand 2 [ Rattus norvegicus ] |
Official Symbol | Cxcl2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; MIP2; CINC-3; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; cytokine-induced neutrophil chemoattractant 3; Mip-2; Scyb2; |
Gene ID | 114105 |
mRNA Refseq | NM_053647 |
Protein Refseq | NP_446099 |
UniProt ID | P30348 |
◆ Recombinant Proteins | ||
Cxcl2-38M | Recombinant Mouse Chemokine (C-X-C Motif) Ligand 2 | +Inquiry |
Cxcl2-2396M | Active Recombinant Mouse Cxcl2 Protein | +Inquiry |
CXCL2-2287HF | Recombinant Full Length Human CXCL2 Protein, GST-tagged | +Inquiry |
CXCL2-121H | Recombinant Human CXCL2 Protein, DYKDDDDK-tagged | +Inquiry |
CXCL2-1348R | Recombinant Rat CXCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cxcl2 Products
Required fields are marked with *
My Review for All Cxcl2 Products
Required fields are marked with *
0
Inquiry Basket