Active Recombinant Mouse Cxcl2 Protein (73 aa)

• Cat.No.: Cxcl2-328C
• Product Overview: Recombinant mouse MIP-2/CXCL2 produced in E. coli is a single non-glycosylated polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmMIP-2/CXCL2 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 73
• Description: Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence to a related chemokine, CXCL1. CXCL2 is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. CXCL2 can signal through the CXCR2 receptor.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: The EC50 value of mouse MIP-2/CXCL2 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCXCR2 cells (human Gα15 and mouse CXCR2 stably expressed in CHO-K1 cells) is less than 1 ng/mL.
• Molecular Mass: 8.0 kDa, observed by reducing SDS-PAGE.
• AA Sequence: GAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant mouse MIP-2/CXCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, mouse MIP-2/CXCL2 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus ]
• Official Symbol: Cxcl2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
• Gene ID: 20310
• mRNA Refseq: NM_009140
• Protein Refseq: NP_033166
• UniProt ID: P10889