Recombinant Mouse Efna4 Protein, Fc-tagged
Cat.No. : | Efna4-050M |
Product Overview : | Purified recombinant protein of Mouse ephrin A4 (Efna4) with C-terminal Fc tag was expressed in HEK293 cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Description : | Broad expression in limb E14.5 (RPKM 20.7), ovary adult (RPKM 14.7) and 18 other tissues. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | RHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Efna4 ephrin A4 [ Mus musculus (house mouse) ] |
Official Symbol | Efna4 |
Synonyms | Efna4; ephrin A4; Epl4; EFL-4; LERK-4; ephrin-A4; EPH-related receptor tyrosine kinase ligand 4 |
Gene ID | 13639 |
mRNA Refseq | NM_007910 |
Protein Refseq | NP_031936 |
UniProt ID | O08542 |
◆ Recombinant Proteins | ||
Efna4-051M | Recombinant Mouse Efna4 Protein, MYC/DDK-tagged | +Inquiry |
EFNA4-233H | Recombinant Human EFNA4 Protein, Fc-tagged | +Inquiry |
EFNA4-177H | Recombinant Human EFNA4 protein, hFc-tagged | +Inquiry |
Efna4-10538M | Recombinant Mouse Efna4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Efna4-1131R | Recombinant Rat Efna4 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA4-001HCL | Recombinant Human EFNA4 cell lysate | +Inquiry |
EFNA4-2158MCL | Recombinant Mouse EFNA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Efna4 Products
Required fields are marked with *
My Review for All Efna4 Products
Required fields are marked with *
0
Inquiry Basket