Active Recombinant Mouse Fgf9 Protein

• Cat.No.: Fgf9-063M
• Product Overview: Purified recombinant protein of Mouse fibroblast growth factor 9 (Fgf9) without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.
• Bio-activity: Determined by a cell proliferation assay using Balb/c 3T3 cells. The expected ED50 is = 10 ng/ml, corresponding to a specific activity of = 1 x 10^5 units/mg.
• Molecular Mass: 23.3 kDa
• AA Sequence: PLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Fgf9 fibroblast growth factor 9 [ Mus musculus (house mouse) ]
• Official Symbol: Fgf9
• Synonyms: Fgf9; fibroblast growth factor 9; Eks; fibroblast growth factor 9; FGF-9; GAF; HBGF-9; elbow knee synostosis; glia-activating factor
• Gene ID: 14180
• mRNA Refseq: NM_013518
• Protein Refseq: NP_038546
• UniProt ID: P54130