Recombinant Human FGF9 Protein, Fc-tagged
Cat.No. : | FGF9-554H |
Product Overview : | Recombinant human FGF9 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 208 |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. |
Form : | Lyophilized |
Molecular Mass : | 50.6 kDa |
AA Sequence : | MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution (reconst). |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FGF9 fibroblast growth factor 9 (glia-activating factor) [ Homo sapiens (human) ] |
Official Symbol | FGF9 |
Synonyms | FGF9; fibroblast growth factor 9 (glia-activating factor); fibroblast growth factor 9; FGF-9; HBGF-9; heparin-binding growth factor 9; GAF; SYNS3; HBFG-9; MGC119914; MGC119915; |
Gene ID | 2254 |
mRNA Refseq | NM_002010 |
Protein Refseq | NP_002001 |
MIM | 600921 |
UniProt ID | P31371 |
◆ Recombinant Proteins | ||
Fgf9-669M | Recombinant Mouse Fgf9 protein | +Inquiry |
FGF9-101H | Active Recombinant Human FGF9 Protein (Pro3-Ser208), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Fgf9-187M | Recombinant Mouse Fgf9 protein, His/S-tagged | +Inquiry |
Fgf9-188R | Recombinant Rat Fgf9 protein, His/S-tagged | +Inquiry |
FGF9-554H | Recombinant Human FGF9 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF9 Products
Required fields are marked with *
My Review for All FGF9 Products
Required fields are marked with *
0
Inquiry Basket