Recombinant Mouse Fkbp1a Protein, His-tagged
Cat.No. : | Fkbp1a-7208M |
Product Overview : | Recombinant mouse Fkbp1a, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-108 |
Description : | This gene is a member of the immunophilin family. The encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, and is associated with immunoregulation, protein folding, receptor signaling, protein trafficking and T-cell activation. It may modulate the calcium release activity of the ryanodine receptor Ryr1. It also interacts with the type I TGF-beta receptor. Disruption of this gene in mouse causes severe ventricular defects. Pseudogenes of this gene have been defined on chromosomes 4, 10, 14, and 16. Alternative splicing results in multiple transcript variants. |
Form : | Liquid |
Molecular Mass : | 14.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 20 % glycerol, 1 mM DTT. |
Gene Name | Fkbp1a FK506 binding protein 1a [ Mus musculus (house mouse) ] |
Official Symbol | Fkbp1a |
Synonyms | Fkbp1a; FK506 binding protein 1a; Fkb; Fkbp; Fkbp1; FKBP12; peptidyl-prolyl cis-trans isomerase FKBP1A; FK506 binding protein 12; PPIase FKBP1A; calstabin-1; immunophilin FKBP12; EC 5.2.1.8 |
Gene ID | 14225 |
mRNA Refseq | NM_001302077 |
Protein Refseq | NP_001289006 |
UniProt ID | P26883 |
◆ Recombinant Proteins | ||
FKBP1A-1540R | Recombinant Rhesus Macaque FKBP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1A-7485H | Recombinant Human FKBP1A protein, His-tagged | +Inquiry |
FKBP1A-4845H | Recombinant Human FK506 Binding Protein 1A, 12kDa, GST-tagged | +Inquiry |
FKBP1A-916H | Recombinant Human FKBP1A Protein, His (Fc)-Avi-tagged | +Inquiry |
FKBP1A-503H | Recombinant Human FK506 Binding Protein 1A, 12kDa, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP1A-6211HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
FKBP1A-6210HCL | Recombinant Human FKBP1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fkbp1a Products
Required fields are marked with *
My Review for All Fkbp1a Products
Required fields are marked with *
0
Inquiry Basket