Recombinant Mouse Hgf Protein
Cat.No. : | Hgf-257M |
Product Overview : | Recombinant Mouse Hgf was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | Non |
Description : | This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the hepatocyte growth factor alpha and beta chains, which heterodimerize to form the mature active protein. Although this protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Homozygous knockout mice for this gene exhibit embryonic lethality due to impaired development of the placenta and liver. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
AA Sequence : | QKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR Betachain:VVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | Hgf hepatocyte growth factor [ Mus musculus ] |
Official Symbol | Hgf |
Synonyms | HGF; hepatocyte growth factor; SF; scatter factor; hepatopoeitin-A; hepatopoietin-A; NK1; NK2; HGF/SF; SF/HGF; C230052L06Rik; |
Gene ID | 15234 |
mRNA Refseq | NM_010427 |
Protein Refseq | NP_034557 |
◆ Recombinant Proteins | ||
HGF-9876B | Recombinant Bovine HGF protein, His-tagged | +Inquiry |
Hgf-8665M | Recombinant Mouse Hgf protein(Met1-Leu728) | +Inquiry |
HGF-13H | Active Recombinant Human HGF Propeptide Protein | +Inquiry |
Hgf-073M | Recombinant Mouse Hgf Protein, MYC/DDK-tagged | +Inquiry |
Hgf-795R | Recombinant Rat Hgf protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
HGF-232P | Native Porcine HGF | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Hgf Products
Required fields are marked with *
My Review for All Hgf Products
Required fields are marked with *
0
Inquiry Basket