Active Recombinant Full Length Human HGF Protein, C-Flag-tagged
Cat.No. : | HGF-607HFL |
Product Overview : | Recombinant Full Length Human HGF Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 79.6 kDa |
AA Sequence : | MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQC ANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTV SITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVE CMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRW EYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLR ENYCRNPDGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNME DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKT KQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEK CKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLR VAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIP NRPGIFVRVAYYAKWIHKIILTYKVPQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Protease, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, Focal adhesion, Melanoma, Pathways in cancer, Renal cell carcinoma |
Full Length : | Full L. |
Gene Name | HGF hepatocyte growth factor [ Homo sapiens (human) ] |
Official Symbol | HGF |
Synonyms | SF; HGFB; HPTA; F-TCF; DFNB39 |
Gene ID | 3082 |
mRNA Refseq | NM_000601.6 |
Protein Refseq | NP_000592.3 |
MIM | 142409 |
UniProt ID | P14210 |
◆ Recombinant Proteins | ||
Hgf-8665MF | Recombinant Mouse Hgf Protein, None-tagged, FITC conjugated | +Inquiry |
HGF-152CAF555 | Recombinant Cynomolgus HGF Protein, None-tagged, Alexa Fluor 555 conjugated | +Inquiry |
HGF-791D | Recombinant Dog HGF protein, His & T7-tagged | +Inquiry |
HGF-115H | Recombinant Active Human HGF Protein, Tag Free | +Inquiry |
HGF-01H | Active Recombinant Human HGF Protein | +Inquiry |
◆ Native Proteins | ||
HGF-38P | Native Porcine HGF | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
HGF-29231TH | Native Human HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HGF Products
Required fields are marked with *
My Review for All HGF Products
Required fields are marked with *
0
Inquiry Basket